PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g005140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family SRS
Protein Properties Length: 320aa    MW: 34202.3 Da    PI: 6.6631
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g005140.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702225.79e-70902472154
          DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.......aeaaskrkrelkskkqsalsst 89 
                     rs t+sC+dCGnqakkdC+h+RCRtCCksrgfdC+thv+stW+p+a+rrerqqql++++s     +        ++ +kr+r++  +   ++ss+
  Csa12g005140.1  90 RSITISCRDCGNQAKKDCTHMRCRTCCKSRGFDCSTHVRSTWIPVARRRERQQQLHMSTSGGGGGSgsggtggGSSIPKRHRDT--TLPGTSSSS 182
                     67899*****************************************************99988877789998888889999986..888899999 PP

          DUF702  90 klssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                     +l+s ++  e+  +s+P evss+a+frcv++s+vddg+ ++aYqt+v+igGh+fkGiLydqG+e+
  Csa12g005140.1 183 RLPSDSAGLEMGEASFPGEVSSDALFRCVKMSGVDDGDGQYAYQTTVNIGGHLFKGILYDQGPES 247
                     ***************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051426.2E-6393246IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.2E-2795137IPR006510Zinc finger, lateral root primordium type 1
Gene3DG3DSA:2.30.27.103.6E-4124182No hitNo description
TIGRFAMsTIGR016242.1E-29198245IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MAGIFSLGGN NNNNNGEEEE ENQQQQKTNW IWYRPNANTN NINPSSSQQI WQIPPEQMLM  60
HHHPQQQQQQ SLDLYPGHQI DVSDLATSSR SITISCRDCG NQAKKDCTHM RCRTCCKSRG  120
FDCSTHVRST WIPVARRRER QQQLHMSTSG GGGGSGSGGT GGGSSIPKRH RDTTLPGTSS  180
SSRLPSDSAG LEMGEASFPG EVSSDALFRC VKMSGVDDGD GQYAYQTTVN IGGHLFKGIL  240
YDQGPESSYM SAGSGGSDHQ SSSAGGGNPF NPPIVADGSG GVSSAMFVDP NSGGYYSSNM  300
TTSVFMPPGT QFYQNPPRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010446810.10.0PREDICTED: protein SHI RELATED SEQUENCE 2-like
SwissprotO655171e-169SRS2_ARATH; Protein SHI RELATED SEQUENCE 2
TrEMBLR0F6A61e-179R0F6A6_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.7__438__AT4G36260.11e-169(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136481727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36260.11e-163Lateral root primordium (LRP) protein-related